PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01996.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 256aa    MW: 28160.2 Da    PI: 6.5142
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01996.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41e-172880452
                                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHH CS
                        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrR 52
                                      ++t+eq+e+Le++++++++p+ ++r++L +++    +++ +q+kvWFqNrR
  Zpz_sc01996.1.g00040.1.sm.mkhc 28 YVRYTPEQVEALERVYAECPKPTSARRQQLLRECpilaNIEPKQIKVWFQNRR 80
                                    6789************************************************* PP

2START56.96.7e-19173233140200
                                     TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHT CS
                           START 140 ssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatl 200
                                     +++vRae+lpSg+l++p+++g+s v++v+h dl++++++++l++l++s+++ ++k++ a l
  Zpz_sc01996.1.g00040.1.sm.mkhc 173 QQFVRAEMLPSGYLVRPCEGGGSIVHIVDHLDLEAWSVPEVLQPLYESSRVVAQKMTAAYL 233
                                     579***************************************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-17780IPR009057Homeodomain-like
PROSITE profilePS5007113.8472280IPR001356Homeobox domain
SMARTSM003897.2E-122490IPR001356Homeobox domain
SuperFamilySSF466891.37E-142780IPR009057Homeodomain-like
CDDcd000867.11E-162780No hitNo description
PfamPF000462.7E-152880IPR001356Homeobox domain
SuperFamilySSF559612.06E-1283219No hitNo description
PROSITE profilePS5084810.49155221IPR002913START domain
Gene3DG3DSA:3.30.530.203.2E-5172215IPR023393START-like domain
PfamPF018523.7E-16173233IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MAAAVAMRSG SSDGGGGYEK GGMDTGKYVR YTPEQVEALE RVYAECPKPT SARRQQLLRE  60
CPILANIEPK QIKVWFQNRR LLSIAEETLT EFVSKATGTA IDWVQMPGMK ATWSGFIVEI  120
LKDRPSWFRD CRSLEVFTMF PAGNGGTIEL VYMQVCERSL SGSGGGQSAA SPQQFVRAEM  180
LPSGYLVRPC EGGGSIVHIV DHLDLEAWSV PEVLQPLYES SRVVAQKMTA AYLLSQFGAI  240
TFRPLLAELH GTYSHA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0138038e-65DQ013803.1 Phyllostachys praecox HB1 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920422.17e-79PREDICTED: homeobox-leucine zipper protein HOX9 isoform X2
SwissprotQ9SE432e-74REV_ARATH; Homeobox-leucine zipper protein REVOLUTA
TrEMBLA0A096QGR29e-80A0A096QGR2_MAIZE; Uncharacterized protein
TrEMBLK7VQU26e-80K7VQU2_MAIZE; Rolled leaf1
STRINGSb01g050000.12e-77(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1849158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.14e-68HD-ZIP family protein